PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma54g00160.1
Common NameZOSMA_54G00160
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family MIKC_MADS
Protein Properties Length: 252aa    MW: 28624.9 Da    PI: 10.0366
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma54g00160.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.41.4e-314393151
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     krien++nrqvtfskRr g++KKA+E+SvLCd+evaviifs++gklyeys+
  Zosma54g00160.1 43 KRIENNINRQVTFSKRRSGLMKKAHEISVLCDVEVAVIIFSTKGKLYEYST 93
                     79***********************************************96 PP

2K-box80.92.9e-27118209899
            K-box   8 sleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                      sl +++ e ++ ++ kLk++ e+Lq++ R+l+GedL+sL+ keL++Le ++e++l+ki+++Kn++l+++i +l+ kek+lq++n a+++kl+
  Zosma54g00160.1 118 SLLQSDGEAWCLQYHKLKRKAESLQKNERNLIGEDLDSLTAKELHNLELRVEDGLRKIKAQKNNVLFDSIADLKIKEKMLQQQNSAMERKLK 209
                      466778899*******************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.2543595IPR002100Transcription factor, MADS-box
SMARTSM004321.5E-393594IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.49E-3336116IPR002100Transcription factor, MADS-box
CDDcd002651.90E-3936113No hitNo description
PRINTSPR004042.7E-303757IPR002100Transcription factor, MADS-box
PROSITE patternPS0035003791IPR002100Transcription factor, MADS-box
PfamPF003197.1E-264491IPR002100Transcription factor, MADS-box
PRINTSPR004042.7E-305772IPR002100Transcription factor, MADS-box
PRINTSPR004042.7E-307293IPR002100Transcription factor, MADS-box
PfamPF014861.9E-22122208IPR002487Transcription factor, K-box
PROSITE profilePS5129713.014124214IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MSLFFNTANG LWTHCFHSLS LSYLSYLASI STAQMGRGRI QLKRIENNIN RQVTFSKRRS  60
GLMKKAHEIS VLCDVEVAVI IFSTKGKLYE YSTDSSMEKI LDRYERFCYA GKDLTEASLL  120
QSDGEAWCLQ YHKLKRKAES LQKNERNLIG EDLDSLTAKE LHNLELRVED GLRKIKAQKN  180
NVLFDSIADL KIKEKMLQQQ NSAMERKLKS ERAAAAAAVA TARTLQREQV KQQRLKSTSS  240
VVPNLNIGYL I*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-2035122187Myocyte-specific enhancer factor 2B
1tqe_Q1e-2035122187Myocyte-specific enhancer factor 2B
1tqe_R1e-2035122187Myocyte-specific enhancer factor 2B
1tqe_S1e-2035122187Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009393064.12e-76PREDICTED: truncated transcription factor CAULIFLOWER A-like
SwissprotQ412743e-70AGL8_SINAL; Agamous-like MADS-box protein AGL8 homolog
TrEMBLA0A0K9NYK80.0A0A0K9NYK8_Z
STRINGGSMUA_Achr4P23540_0012e-73(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP115137113
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60910.14e-70AGAMOUS-like 8